General Information

  • ID:  hor000500
  • Uniprot ID:  A0A8J5MS43
  • Protein name:  Allatostatin B
  • Gene name:  AstB1-L
  • Organism:  Homarus americanus (American lobster)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  exhibited higher signal intensities in the adult than embryo
  • Taxonomy:  Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  NWNKFQGSW
  • Length:  9(78-86)
  • Propeptide:  MMTAQQMCRPWALLMVVLVAGATQVSSSSSSPQQDDPASSPSHIEEKRVGWSSMHGTWGKRPHLEDAQLDAAEVKRTNWNKFQGSWGKRGEELQAAEDKRTNWNKFQGSWGKRGDDLADAEL
  • Signal peptide:  MMTAQQMCRPWALLMVVLVAGATQVSS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000500_AF2.pdbhor000500_ESM.pdb

Physical Information

Mass: 130913 Formula: C55H71N15O14
Absent amino acids: ACDEHILMPRTVY Common amino acids: NW
pI: 9.7 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -162.22 Boman Index: -1919
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 3738.89 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1375

Literature

  • PubMed ID:  18304551
  • Title:  Mass Spectral Characterization of Peptide Transmitters/Hormones in the Nervous System and Neuroendocrine Organs of the American Lobster Homarus Americanus